PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.F00621.3.p
Common NameEUGRSUZ_F00621
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family WRKY
Protein Properties Length: 459aa    MW: 49417.1 Da    PI: 5.2242
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.F00621.3.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY95.82.9e-30243300260
                       --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
              WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                       dDgynWrKYGqK+vkg efprsYY+Ct+++C+vkk  er+  d++++ei+Y+g+H+h+k
  Eucgr.F00621.3.p 243 DDGYNWRKYGQKHVKGCEFPRSYYKCTYPNCEVKKLFERAP-DGHITEIIYKGTHDHPK 300
                       8****************************************.***************85 PP

2WRKY35.32.4e-11420442123
                       ---SS-EEEEEEE--TT-SS-EE CS
              WRKY   1 ldDgynWrKYGqKevkgsefprs 23 
                       ldDgy+WrKYGqK+v+g+++pr 
  Eucgr.F00621.3.p 420 LDDGYRWRKYGQKVVRGNPNPRY 442
                       59*******************94 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081122.24237301IPR003657WRKY domain
Gene3DG3DSA:2.20.25.802.4E-26237301IPR003657WRKY domain
SuperFamilySSF1182903.92E-24237301IPR003657WRKY domain
SMARTSM007741.8E-31242300IPR003657WRKY domain
PfamPF031064.3E-23243299IPR003657WRKY domain
Gene3DG3DSA:2.20.25.802.1E-13405442IPR003657WRKY domain
SuperFamilySSF1182901.7E-9412443IPR003657WRKY domain
PROSITE profilePS5081115.767415458IPR003657WRKY domain
SMARTSM007741.1E-4420451IPR003657WRKY domain
PfamPF031063.5E-7421444IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009611Biological Processresponse to wounding
GO:0009961Biological Processresponse to 1-aminocyclopropane-1-carboxylic acid
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 459 aa     Download sequence    Send to blast
MGSPPAPDFE PHEFQFRSAA DPSPGGPFSD SDAGPLAGGG GCGGGGGGGA RYKLLSPAKL  60
PISRSACITI PPGLSPTSFL ESPVLLSNVK VEPSPTTGSL IKPHMMNGLI GSNSDTRLAN  120
SGCPDSFDEG RSGIFEFKPL ATSNLVPTEA KHQGSEQAVK VSGQRHSQPF ASLSSVQSDL  180
AVSSKELCLS VPTQAVRSGA SPLAEADPDG LLGRKEQPNN VMQVTQLDNK GNGPSVMTER  240
LSDDGYNWRK YGQKHVKGCE FPRSYYKCTY PNCEVKKLFE RAPDGHITEI IYKGTHDHPK  300
PQPSRRFTGG ATMPIQEERS DRFSFIPAVE STSTVYGETS YNVETDGTPE LSPVAENDET  360
IEGAASLSNR IQNEVDDGDD DDPFLKRRRL DIGGEDVTPV VKPIREPRVV VQTLSEVDIL  420
DDGYRWRKYG QKVVRGNPNP RYSFAAMVDL QSVLLFCL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A5e-152413011677Probable WRKY transcription factor 4
1wj2_A5e-152413011677Probable WRKY transcription factor 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1385389KRRRL
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00455DAPTransfer from AT4G26640Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.F00621.3.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010060240.10.0PREDICTED: probable WRKY transcription factor 20
SwissprotQ93WV01e-126WRK20_ARATH; Probable WRKY transcription factor 20
TrEMBLA0A059BME00.0A0A059BME0_EUCGR; Uncharacterized protein
STRINGVIT_19s0090g01720.t011e-158(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G26640.21e-128WRKY family protein